PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID KZV18373.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Gesneriaceae; Didymocarpoideae; Trichosporeae; Loxocarpinae; Dorcoceras
Family ZF-HD
Protein Properties Length: 249aa    MW: 27494 Da    PI: 7.9279
Description ZF-HD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
KZV18373.1genomeCNUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1ZF-HD_dimer98.16.8e-3152106358
  ZF-HD_dimer   3 kvrYkeClkNhAaslGghavDGCgEfmpsegeegtaaalkCaACgCHRnFHRreve 58 
                   vrY+eC+kNhAa++Gg+++DGCgEfmps g+egt +al CaAC CHRnFHR+e++
   KZV18373.1  52 MVRYHECQKNHAANIGGNVTDGCGEFMPS-GDEGTLEALMCAACSCHRNFHRKEHH 106
                  69**************************9.999********************976 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD1257748.0E-2148104IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
PfamPF047706.1E-2853105IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
TIGRFAMsTIGR015669.5E-2954104IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
PROSITE profilePS5152325.66155104IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
SuperFamilySSF466894.09E-18175243IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.602.7E-29178244IPR009057Homeodomain-like
TIGRFAMsTIGR015657.9E-29182238IPR006455Homeodomain, ZF-HD class
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 249 aa     Download sequence    Send to blast
MALNAGEDKD MRIQSASIGL DNSPENPSSE QERTRIHDPN PGGSKSRVAS PMVRYHECQK  60
NHAANIGGNV TDGCGEFMPS GDEGTLEALM CAACSCHRNF HRKEHHSGEG GAGMVHPLHL  120
PPPLPSPLVS LHRGGSSHWS PMVQPVKMAF VGGGSVGTDS SSEELNFNSL QVAPPPPHFL  180
SKKRFRTKFT PDQKEKMMEF AEKLGWRIPR EDDSEMQRFC AEVGVKRQVF KVWMHNNKIN  240
SSKKNSQEI
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wh7_A2e-241812381673ZF-HD homeobox family protein
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011083674.11e-113PREDICTED: zinc-finger homeodomain protein 5
SwissprotQ9M9S06e-66ZHD4_ARATH; Zinc-finger homeodomain protein 4
TrEMBLS8C3822e-88S8C382_9LAMI; Uncharacterized protein (Fragment)
TrEMBLA0A068UH152e-88A0A068UH15_COFCA; Uncharacterized protein
STRINGPGSC0003DMT4000095812e-81(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA51824128
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G14440.27e-55homeobox protein 31